Tesamorelin + Ipamorelin is supplied as a laboratory research reference material intended strictly for in-vitro and laboratory research use only. The blend pairs two synthetic peptides of distinct architecture in a single lyophilized presentation, allowing analytical laboratories and formulation chemists to characterize each component and the mixture as a whole under a single catalog identifier (SKU: TESA-IPAM-BLEND).
The Tesamorelin component is a 44-residue-derived GHRH analog sequence supplied here as the 29-residue C-terminally amidated fragment YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, with molecular formula C221H366N72O67S and a monoisotopic-consistent average molecular weight of approximately 5196 g/mol. Its 3-letter sequence, Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Asn-His (31 residues as tabulated with N-terminal modification), features a single methionine that analysts should note as a potential oxidation site during method development, alongside multiple basic residues (Arg, Lys, His) that dominate its charge state envelope in positive-mode ESI-MS.
The Ipamorelin component is a compact pentapeptide with molecular formula C38H49N9O5 and an average molecular weight of approximately 711.9 g/mol, sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2. The presence of alpha-aminoisobutyric acid (Aib), D-2-naphthylalanine, and D-phenylalanine gives it a non-standard amino-acid signature that is readily distinguishable from Tesamorelin by reverse-phase HPLC retention behavior, UV absorbance from the naphthyl chromophore, and mass spectrometric fragmentation patterns, making the Tesamorelin + Ipamorelin blend a convenient dual-analyte reference for orthogonal separation and detection method work.
Both peptides are of synthetic origin and are presented as a white to off-white lyophilized powder. Purity is specified as not less than 98% by HPLC, with identity, purity, counter-ion content, and residual solvent data documented on the lot-specific Certificate of Analysis, available on request. The pronounced difference in molecular weight (~5196 vs. ~711.9 g/mol) supports clean resolution by size-exclusion chromatography and unambiguous discrimination in LC-MS workflows, and reference laboratories routinely use such disparate mass pairs to challenge dynamic range, ion suppression, and peak-capacity parameters.
Published scientific literature has examined Tesamorelin + Ipamorelin in preclinical and analytical contexts, and PEPTIDE.Power provides this material solely as a characterized chemical reference. PEPTIDE.Power makes no therapeutic, diagnostic, or efficacy claims regarding Tesamorelin + Ipamorelin and provides no administration or dosing guidance. This material is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion.





Reviews
There are no reviews yet.